PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g23060.1.p
Common NameBRADI_1g23060, LOC100830802
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 611aa    MW: 66392 Da    PI: 6.3297
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g23060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.41.3e-932016092374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                        +lL+ecA+av+s+d +++q+l++ l+elasp+gd  q+la+yf++AL arl+ s++++ ++l++ ++++++ +++  +   f+e+sP+  f+
  Bradi1g23060.1.p 201 SQLLMECARAVASRDSTRVQQLMWMLNELASPYGDVEQKLASYFLQALFARLTASGPRTLRTLAAATDRNTSFDSTRRVALKFQELSPWSSFG 293
                       589************************************************************9999986555555455555*********** PP

              GRAS  95 hltaNqaIleavege.........ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg......skeeleetgerLakfAee 171
                       h++aN aIle++ ++         +r Hi+D++ + ++QWp+Ll+aLa+R+ +++p+l iT+v+ ++s+       ++ ++e+g+r++kfA+ 
  Bradi1g23060.1.p 294 HVAANGAILESFLEAaaaapssepQRFHILDLSNTFCTQWPTLLEALATRSpDDTPHLSITTVHVSSSSaasspaVQRVMREIGQRMEKFARL 386
                       **********99777677788888999***********************9899**********988878999999999************** PP

              GRAS 172 lgvpfefnvlvak.rledleleeLrvkp...gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh.nse........ 251
                       +gvpf+f++++++ +l++l+l++L+v++      +aVn+v +l  +       + +r e+  l+++l P+vv+vve+ead   ++        
  Bradi1g23060.1.p 387 MGVPFRFRAVHHSgDLAELDLDALDVREggaTTGIAVNCVNSLRGVG------ARRRGEFAALLRRLGPRVVTVVEEEADFvADSdhhrsadq 473
                       **********8888**************6555568********9998......556789*******************88854446789999* PP

              GRAS 252 .......sFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqa 337
                               Fl+ f e l+++sa +dsle+++p++s+er  +Er   gr+iv++v+c  +e+ er+et++ W +rl+ aGF+pv++s+++a+++
  Bradi1g23060.1.p 474 daetdqaAFLKVFGEGLRFFSAYMDSLEESFPKTSNERLALERG-AGRAIVDLVSCPASESMERRETAAAWARRLRCAGFSPVAFSDDVADDV 565
                       ******9*************************************.************************************************ PP

              GRAS 338 klllrkvksdgyrve....ee....sgslvlgWkdrpLvsvSaWr 374
                       ++llr++  +g+++     e+     + ++l Wk++pLv++SaWr
  Bradi1g23060.1.p 566 RSLLRRYR-EGWSMRdagaEDsaaaGAGVFLQWKEQPLVWASAWR 609
                       *******9.888888445522566355566**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.408174582IPR005202Transcription factor GRAS
PfamPF035144.6E-91201609IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 611 aa     Download sequence    Send to blast
MDTLFRLVSL QATTEQQQQQ QQQSASYNSR STTSSGSRSS SHHTTASYSY YNSGSGSGGQ  60
PQQQYYYSQP QQSYYLEPYH EECGGGNAHQ DHHQHHQQHQ HQQQQLYMDE DFSSSSSSRH  120
FGGHHGSHGG QQQQPSSTPP LSTTSSTAAG HALFEPAELS FPPDLNLDFS SPASSSGGGI  180
AAASASSPAV IGGAGGGRWA SQLLMECARA VASRDSTRVQ QLMWMLNELA SPYGDVEQKL  240
ASYFLQALFA RLTASGPRTL RTLAAATDRN TSFDSTRRVA LKFQELSPWS SFGHVAANGA  300
ILESFLEAAA AAPSSEPQRF HILDLSNTFC TQWPTLLEAL ATRSPDDTPH LSITTVHVSS  360
SSAASSPAVQ RVMREIGQRM EKFARLMGVP FRFRAVHHSG DLAELDLDAL DVREGGATTG  420
IAVNCVNSLR GVGARRRGEF AALLRRLGPR VVTVVEEEAD FVADSDHHRS ADQDAETDQA  480
AFLKVFGEGL RFFSAYMDSL EESFPKTSNE RLALERGAGR AIVDLVSCPA SESMERRETA  540
AAWARRLRCA GFSPVAFSDD VADDVRSLLR RYREGWSMRD AGAEDSAAAG AGVFLQWKEQ  600
PLVWASAWRP *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-192026096375GRAS family transcription factor containing p
Search in ModeBase
Function -- GeneRIF ? help Back to Top
  1. all of the SHR proteins function as mobile signals
    [PMID: 25352666]
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562791.10.0PREDICTED: protein SHORT-ROOT 1
SwissprotQ8H2X80.0SHR1_ORYSJ; Protein SHORT-ROOT 1
TrEMBLA0A0Q3GWS30.0A0A0Q3GWS3_BRADI; Uncharacterized protein
STRINGBRADI1G23060.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35263781
Representative plantOGRP27551332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.11e-136GRAS family protein
Publications ? help Back to Top
  1. Wu S, et al.
    A plausible mechanism, based upon Short-Root movement, for regulating the number of cortex cell layers in roots.
    Proc. Natl. Acad. Sci. U.S.A., 2014. 111(45): p. 16184-9
    [PMID:25352666]